PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0824s00030.1
Common NameLR48_Vigan05g154400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 277aa    MW: 31542.8 Da    PI: 4.4435
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0824s00030.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-161360148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g WT+eEd +lv +v+++G+ +W+  +r  g+ R++k+c++rw++yl
  Vang0824s00030.1 13 KGTWTPEEDRKLVAYVTRYGSWNWRQLPRFAGLARCGKSCRLRWLNYL 60
                      799*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.7E-22763IPR009057Homeodomain-like
PROSITE profilePS5129423.215864IPR017930Myb domain
SMARTSM007177.3E-111262IPR001005SANT/Myb domain
PfamPF002494.4E-141360IPR001005SANT/Myb domain
SuperFamilySSF466897.27E-201486IPR009057Homeodomain-like
CDDcd001672.03E-91560No hitNo description
PROSITE profilePS500904.0196191IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.608.0E-76485IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MRTPSWDNRG LKKGTWTPEE DRKLVAYVTR YGSWNWRQLP RFAGLARCGK SCRLRWLNYL  60
RPNIKRGNYT DKEEETIIKL HEKLASKSNS FGSNPDKDCI ENNGFFLEAS HSPTVSKASD  120
PDPLSPELSS SEFSSSDYTT HQNLFLEDGF DFLDAYLADM NQNISTESFH ISQVTSQANG  180
IDNFHGSDAP KTMECVRPES PLSYYNENSL VENDDFGFLE EIEPITEHSW TEAFVADMSL  240
IPNELLVPLV NESESYFSSA YDVDDIWCLK NNSHMI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-12118725100MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014491673.11e-149PREDICTED: transcription factor WER-like
TrEMBLA0A0L9UN460.0A0A0L9UN46_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SH860.0A0A0S3SH86_PHAAN; Uncharacterized protein
STRINGGLYMA12G32541.11e-88(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1674767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.12e-35myb domain protein 14
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]